<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2058 2058-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54L, I84V, L90M V11VI, L33F, G73S L10I, L19I, E34Q, R41K, K55N, I62V, L63P, A71I, I72R, V77I, I93L  
>2058-30625| codons 4-99
TLWQRPIITIKIGGQIKEALLDTGADDTVFQEMNLPGKWKPKIVGGIGGFLNVRQYDQVP
IEICGHKIRSTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KN   A98AG K43E, E44A, K49KR, R83K, K102KQ, V118I, K122E, I135IT, T200I, I202V, R211K  
>2058-30625| codons 38-247
CTELEEAGKISRIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
GGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRIKVEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006