<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
143P10 143P10W56 U.S. 1992 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 DDI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y       K49R, R83K, V90I, S162D, R211K K220KT
>143P10W56| codons 26-242
LTEEKIKALVEICTELEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQ
DFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEEL
RQHLWKWGFYTPDKTHQKEPPFLWMGYELHPDKWTVQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19Q, N37C, I64V  
>143P10W56| codons 1-99
PQITLWQRPLVTIKIGGQQKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Winters, MA Human immunodeficiency virus type 1 reverse transcriptase genotype and drug susceptibility changes in infected individuals receiving dideoxyinosine monotherapy for 1 to 2 years. AAC, 1997
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005