<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2043 2043-30609 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82S L33F, T74P L10I, I13V, E34Q, N37S, I62V, L63P, A71V, V77I  
>2043-30609| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFQEMSLPGRWKPKMIVGIGGFTKVRQYDQVP
IEICGHKVIGPVLIGPTPSNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, V75T, M184V, L210W, T215Y A62V     K43Q, V118VI, K122E, I135IMV, S162C, G196GE, E203EK, H208HY, R211K, K223Q  
>2043-30609| codons 38-247
CTELEQEGKISKIGPENPYNTPVFVIKKKNSTKWRKVTDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006