<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2040 2040-30603 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q Y188L   T39A, V106I, V118I, K122E, D123E, I135T, T165I, T200I, R211K, F214L, D218E, L228H  
>2040-30603| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVIYQYVDDLLVGSDLEIGQHRIKIEELRQHLLKWGLFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A, L90M L10F, V11VI, L33LI, K43KT, G73GS, L89V I13V, K14KR, Q18H, K20I, E35D, M36I, N37D, I62V, L63P, A71I, I72L  
>2040-30603| codons 4-99
TLWQRPFITVRIGGHLIEALLDTGADDTVIEDIDLPGRWTPKMIGGIGGFAKVRQYDQVP
IEICGHKILSTVLVGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006