<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2039 2039-30602 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M V11I, L33F L10I, I13V, E35D, M36I, N37Q, R41K, K55R, I62V, L63P, A71T, I72L, G73V  
>2039-30602| codons 4-99
TLWQRPIITVKIGGQLKEALLDTGADDTIFEDIQLPGKWKPKIVGGIGGFLRVRQYDQVP
IEICGHKTLVTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215Y K219N K101E, Y181C, G190A A98G, V108I T39A, K43E, S68G, V118I, D123E, I135T, T200TI, H208Y, R211K, D218E, K223Q, V245VE  
>2039-30602| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTILDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRIKIEELRQYLLKWGFYTP
ENKHQQEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006