<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1917 1917-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219N G190A   K43E, E44A, V90VI, V118I, K122E, I142V, T200I, E203D, H208Y, R211RK, V245K  
>1917-30519| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRIKIDELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48GA, I54V, V82A L24I, L33F, G73GS L10I, K20R, E35D, M36I, R41K, K55KR, R57K, D60E, I62V, L63P, A71V, I72IT, I93IL  
>1917-30519| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVFEDINLPGKWKPKLIAGIGGFVRVKQYEQVP
IEICGHKVTSTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006