<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1510 1510-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70E, L74V, M184V, T215Y   K101E, Y181C, G190A   K43E, V60I, K122E, I135T, S162Y, T200A, E224ED  
>1510-30519| codons 38-247
CTELEEEGKISKIGPENPYNTPIFAIKKKNSTEWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRAKIEELRQHLLRWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F L10I, G16A, N37NS, R41RK, I62V, L63P, I66F, C67Y, A71T, I72R, I93L, C95F  
>1510-30519| codons 4-99
TLWQRPIVTIKIAGQLKEALLDTGADDTVFEEMSLPGKWKPKLIGGIGGFVKVRQYDQVP
IEFYGHKTRGTVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006