<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1509 1509-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   K103N, Y181C   K43E, E44A, K102R, V118I, K122E, I135T, I142V, K166R, Q207E, R211K  
>1509-30515| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, V82A, L90M L33F, F53L L10V, I13V, K20R, E35D, M36I, N37D, R57K, I62V, L63P, A71V, I72IV  
>1509-30515| codons 4-99
TLWQRPVVTVKIGGQLREALLDTGADDTVFEDIDLPGRWKPKIIGGIGGLIKVKQYDQVP
IEICGHKVVGTVVVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006