<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1505 1505-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, V82A, I84V L33F, G48E, Q58E L10I, I13V, I15IV, K20R, E35D, M36I, N37S, R41K, K55R, R57K, D60E, L63P, A71V, I93L  
>1505-30515| codons 4-99
TLWQRPIVTVKVGGQLREALLDTGADDTVFEDISLPGKWKPKIIEGIGGFMRVKEYEQIP
IEICGHKVIGTVVVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M A62V, V75I, F77L, F116Y Y181C   S68G, K166R, F214L, V245T  
>1505-30515| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006