<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2202 2202-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, T74P I13V, L33M, K55R, R57K, I62V, L63P, C67CY, L89I, T91S  
>2202-30717| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTVMEEMNLPGRWKPKIIGGIGGFVRVKQYDQVP
IEIYGHKAIGPVLVGPTPVNVIGRNIMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219KR G190A K101H, V108I K43Q, E44D, V60I, V106VI, V118I, D123E, V189VI, T200A, E203D, H208Y, R211K, H221Y, V245M  
>2202-30717| codons 38-247
CTELEQDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSITILDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYIASDLEIGQHRAKIDELRQYLWKWGFYTP
DRKYQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006