<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1501 1501-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L10F, L33F, Q58E, G73GS, L89V E34Q, D60DEKN, L63P, H69Q, K70KE, A71V, I93L  
>1501-30527| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTIFQEMNLPGRWKPKIVGGIGGFLKVREYNQIP
IEICGQEVISTVLVGPTPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, M184I, T215Y K70Q Y188L   V60I, V118I, K122E, I135L, I142T, V179I, T200A, H208Y, R211RK, F214L, K223Q  
>1501-30527| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTQWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGTRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYIDDLLVGSDLEIGQHRAKIEELRQYLLKWGLYTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006