<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1154 1154-30722 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47V, I54L, I84V, L90M L33F, G73ST, L89LV L10I, I15V, L19LI, K20R, E34EV, E35D, M36I, N37D, K55KR, I62V, L63P, A71V  
>1154-30722| codons 4-99
TLWQRPIVTIKVGGQIREALLDTGADDTIFVDIDLPGRWKPKIVGGIGGFLRVRQYDQVP
IEICGHKVITTVLVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215F K219Q K101P, G190A   T69N, K122E, D123N, I135M, E169D, R211K, L228H  
>1154-30722| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSNKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLPKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006