<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1153 1153-30709 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S, L90M V11VI, L33LF, G73T L10I, K20IM, E34Q, E35D, M36I, D60E, I62V, L63P, C67L, A71V, I72L  
>1153-30709| codons 4-99
TLWQRPIITIKIGGQLMEALLDTGADDTVFQDINLPGRWKPKMIVGIGGFVKVRQYEQVP
IEILGHKVLTTVLVGPTPSNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N Y181C, G190A F227L T39TA, K43N, E44D, V106I, L109LI, V118I, D123E, I135IT, S162Y, E169D, V179I, H208Y, R211RK, D218E, H221Y K101LV
>1153-30709| codons 38-247
CAELENDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLVKKKSITVIDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILDPFRKQNPDIIICQYMDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTP
ENKYQKEPPLLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006