<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1152 1152-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V L10F, L23I, L33F, F53L, G73GS I13V, G16GA, N37ND, L63P, V77I, I93L  
>1152-30701| codons 4-99
TLWQRPFVTVKIAGQLKEAILDTGADDTVFEEMDLPGRWKPKIIGGVGGLIKVRQYDQIP
IEICGHKAISTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Y115F, Q151M, M184V, T215Y A62V, V75I, F77L, F116Y, K219Q K103N   A158S, D177N, G196E, I202IV W229G
>1152-30701| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKNSDRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAFYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
SIFQSSMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFYTP
DQKHQKEPPFLGMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006