<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1761 1761-30410 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M V11VIL, L33F, K43T, T74P L10I, I13V, K20R, E35D, M36I, N37E, K55R, I62V, L63P, A71V, I93L  
>1761-30410| codons 4-99
TLWQRPILTVKIGGQLREALLDTGADDTVFEDIELPGRWTPKIIGGIGGFVRVRQYDQVP
IEICGHKVIGPVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74IV, Y115F, M184V D67DG, K219E K101E, Y181C, G190A V108I I50V, V118VI, K122E, G196K, Q197K, R211K, H221Y, V245M  
>1761-30410| codons 38-247
CTEMEKEGKISKVGPENPYNTPVFAIKKKGSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTILDVGDAFFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIKKHRTKIEELRQHLLKWGFTTP
DEKYQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006