<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1490 1490-30327 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M V11VI, G73T L10I, I13IV, K14KR, I15V, K20I, M36I, I62V, L63P, A71IV, I72IR, P79D, I85V, T91S, I93L  
>1490-30327| codons 4-99
TLWQRPIITVRVGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKVRTTVLVGDTPVNVVGRNLMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219D Y181C, Y188L   K43E, E44A, K102Q, V118I, K122E, D123DN, T139K, S162A, T165I, Q197K, T200A, D218E, L228H  
>1490-30327| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSP
AIFQASMIKILEPFRKQNPDIVICQYMDDLLVGSDLEIGKHRAKIEELRQHLWRWGFYTP
EDKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006