<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1272 1272-30721 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K101KE F227L K43Q, E44D, V118I, K122E, L187F, E203K, H208Y, R211K, K223E Q182QP, D186H
>1272-30721| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYPYMDHFYVGSDLEIGQHRTKIKELRQYLWKWGFYTP
DNKHQEEPPLLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A, L90M L33F, F53FL, Q58QE L10I, L19V, E35ED, M36L, N37S, R57RK, I62V, L63P, C67CY, A71V  
>1272-30721| codons 5-99
LWQRPIVTIKIGGQVKEALLDTGADDTVFEDLSLPGRWKPKLIGGIGGLVKVKEYDQVPI
EIYGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006