<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1861 1861-30530 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F, V11I, G73T T12P, K14T, I15V, G16A, L19E, K20I, M36I, L63P, I64V, A71V, I72V, I85V, T91V, I93L  
>1861-30530| codons 4-99
TLWQRPFIPITVAGQEIEALLDTGADDTVLEEINLPGRWKPKIVGGIGGFVKVRQYDQIP
VEICGHKVVTTVLVGPTPVNVVGRNLMVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N K101E, Y181C, G190A   T39A, K64R, V118I, K122E, I135T, G196E, T200TA, I202V, H208Y, R211K  
>1861-30530| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIRKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIEQHRAKVEELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006