<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1859 1859-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IM, I84V, L90M L33F L10I, I13V, I15V, K20R, E21Q, E35D, M36I, N37D, R41K, I62V, L63P, A71AV, T74E, P79A, V82I, I85V, I93L  
>1859-30519| codons 4-99
TLWQRPIVTVKVGGQLRQALLDTGADDTVFEDIDLPGKWKPKLIGGIGGFMKVRQYDQVP
IEICGHKVIGEVLVGATPINVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N L100I, K103N, Y181YC A98G T39A, E44D, V111I, K122E, M164ML, E203K, H208Y, R211H, K223E, L228H  
>1859-30519| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGIKKNKSVTVLDIGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSLTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIKELRQYLWHWGFYTP
DNKHQEEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006