<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1758 1758-30710 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L76V, V82C, I84IV   L10IV, I15IV, L19I, K20R, E35D, M36I, N37D, D60E, Q61EK, I62IV, L63P, A71V, I93L  
>1758-30710| codons 4-99
TLWQRPVVTIKVGGQIREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVKVRQYEKVP
IEICGHKVIGTVVVGPTPCNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y       K43KQ, V118I, K122E, S162A, K173T, G196GE, Q207E, R211K, P243S, V245T  
>1758-30710| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQSITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006