<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1755 1755-30512 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, V75M, M184V, T215F K219Q L100I, K103N   V60I, V118I, I135V, I202V, R211K, F214L, L228H, D237E  
>1755-30512| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGLFTP
DQKHQKEPPFHWMGYELHPEKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, I15V, L19Q, K20M, N37S, K55R, L63P, A71V, Q92K M36R
>1755-30512| codons 4-99
TLWQRPIVTIKVGGQQMEALIDTGADDTVLEERSLPGRWKPKLIGGIGGFVRVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006