<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1288 1288-30408 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46ML L33LI, N88D I13V, A22V, R57K, I62IV, L63P, A71V  
>1288-30408| codons 4-99
TLWQRPLVTVKIGGQLKEVLLDTGADNTVIEEMNLPGRWKPKLIGGIGGFIKVKQYDQVP
IEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, T215FL A62V, V75I, K219Q G190S   K101Q, V106VI, K122E, I135L, V245M  
>1288-30408| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSITVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGFLTP
DQKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006