<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1287 1287-30407 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, M184V, L210W, T215Y   K101P, K103N   K43Q, D123N, I135T, K166R, D177E, G196E, T200A, R211K, D218E  
>1287-30407| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLPKNKSVTVLDVGDAYFSVPLDKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRAKIEELRQHLWKWGFYTP
EKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L24I, L33I L10I, I13V, L19Q, K20M, M36I, D60E, L63P  
>1287-30407| codons 4-99
TLWQRPIVTVKIGGQQMEALIDTGADDTVIEEINLPGRWKPKIIGGIGGFVKVRQYEQIP
IEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006