<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1286 1286-30404 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V L24I L10I, I13V, K14KR, L19V, K20R, E35D, M36I, L63P, A71T  
>1286-30404| codons 4-99
TLWQRPIVTVRIGGQVREALIDTGADDTVLEDINLPGRWKPKLIGGIGGFIKVRQYDQIP
IEICGHKTIGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R   K103N P225H W88C, I142V, I178M, F214L, L228R, V245E  
>1286-30404| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSDRWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
DKKHQKEHPFRWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006