<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1284 1284-30307 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L33F, Q58E, L89V I13V, I15V, E34Q, L63P, A71V, T74S, V77I, Q92R, I93F  
>1284-30307| codons 4-99
TLWQRPLVTVKVGGQLKEALLDTGADDTIFQEMNLPGRWKPKIVGGIGGFMKVREYDQIP
IEICGHKVIGSVLIGPTPVNVIGRNVMTRFGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74IV, M184V, L210W, T215Y V75M     E40F, K43E, S68SG, V118I, K122E, I135T, I178M, R211K, V245K  
>1284-30307| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKNGTKWRKVMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006