<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1466 1466-30606 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48M, I50V, I54S, V82A, L90M K43T L10IV, E34Q, F53Y, I62V, L63P, I64V, A71V, I72V, V77I, I85V, I93L  
>1466-30606| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWTPKIIMGVGGYSKVRQYDQVP
VEICGHKVVGTVLIGPTPANIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74V, T215F K219Q K103N   S68SG, K102KR, V118I, K122E, R211Q, F214L, D218E  
>1466-30606| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLQWGLFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006