<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1464 1464-30603 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215CY A62V L100I, K103N   K43E, E44A, V118I, K122E, T139R, D177E, I202V, Q207E, L228R E53EK
>1464-30603| codons 38-247
CTELEEAGKISKIGPKNPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKVEELREHLWRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54M, I84V, L90M L10F, L33LF E34EQ, I62IV, L63P, I66V, A71V, V77I, I85IV, I93L D29DV
>1464-30603| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGAVDTVFQEMNLPGRWKPKIVGGIGGFMKVRQYDQVP
IEVCGHKVIGTVLIGPTPVNVVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006