<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1794 1794-30714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215Y K219Q K103N, Y181C A98G, V108I V60I, K122E, T200A, E203D, Q207E, R211K, F214FL, D218E, L228H, V245E  
>1794-30714| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRAKIDELREHLLKWGLYTP
EQKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M L10F, K43T, N88D I13M, L19I, K20R, E35D, M36I, K55R, R57RK, I62V, L63P, I66V, H69Q, A71V, Q92K, I93L, C95F, T96S  
>1794-30714| codons 4-99
TLWQRPFVTMKIGGQIREALLDTGADDTVLEDINLPGRWTPKIIGGIGGFVRVKQYDQVP
IEVCGQKVIGTVLVGPTPTNIIGRDLMTKLGFSLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006