<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1793 1793-30609 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, L74I, M184V, T215F K219Q Y181V   K101Q, S162SC, E169D, Q174N, R211S, L228H  
>1793-30609| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKNNPDIVIVQYVDDLYVGSDLEIGQHRTKIEELRQHLLSWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, V82A, L90M   L10IV, I15V, E34Q, M36I, R41K, K55R, I62V, L63P, A71V, I72IV, T74S, I93L  
>1793-30609| codons 4-99
TLWQRPVVTIKVGGQLKEALLDTGADDTVLQEINLPGKWKPKIIGGIGGFMRVRQYDQVP
IEICGHKVVGSVVVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006