<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1791 1791-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103N   K46Q, S68G, A98S, V118I, D121Y, K122E, E169D, G196E, T200A, Q207H, R211K, F214L E194T
>1791-30528| codons 38-247
CTEMEKEGQISKIGPENPYNTPVFAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYMDDLYVGSDLTIEQHRAKIEELRHHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V, L90M L10F N37D, L63P, A71V, I72R, I93L  
>1791-30528| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYDQIP
IEICGHKVRGTVVVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006