<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1716 1716-30421 U.S. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L24I, L33F, K43T L10I, I15V, K20R, E35D, M36I, N37ND, R41K, I62V, L63T, H69K, T74S, L89M, I93L  
>1716-30421| codons 4-99
TLWQRPIVTIKVGGQLREALIDTGADDTVFEDIDLPGKWTPKLIGGIGGFVKVRQYDQVT
IEICGKKAIGSVLVGPTPANVIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N   T39E, S48T, V60I, K122E, D123N, K173T, Q174K, D177E, I178M, T200A, Q207E, L228LH, V245Q  
>1716-30421| codons 38-247
CEELEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPEMVIYQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006