<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1147 1147-30325 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82C, L90M L10F, G73S T12A, I13V, I15V, L19P, K20I, E35DN, M36I, N37E, R41K, K55R, L63P, A71V, I72R, I93L  
>1147-30325| codons 4-99
TLWQRPFVAVKVGGQPIEALLDTGADDTVLENIELPGKWKPKIIGGIGGFVRVRQYDQIP
IEICGHKVRSTVLVGPTPCNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V K70Q K103N, Y181C, G190A   K101Q, V106I, K122E, I135T, S162C, Q174K, T200A, Q207A, H221Y, L228H, V245K  
>1147-30325| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTQWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSITVLDVGDAFFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKKNPDIVICQYVDDLYVASDLEIGQHRAKIEELRAHLLRWGFTTP
DKKYQKEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006