<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1442 1442-30603 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, L210W, T215Y K219E K103N, Y181C V108I V118I, K122E, V179I, Q207A, D218E, L228H  
>1442-30603| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRTKIEELRAHLWRWGFYTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, I84V, L90M L10F, L33F, K43T, G73T K20R, E34Q, E35D, M36I, R57K, I62V, L63P, I66V, A71V, I72T  
>1442-30603| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTVFQDINLPGRWTPKMIGGIGGFMKVKQYDQVP
IEVCGHKVTTTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006