<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1444 1444-30603 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A L33F L10V, I13V, K14KR, K20R, N37D, L63P, A71V, I72IM, I93L  
>1444-30603| codons 4-99
TLWQRPVVTVRIGGQLREALLDTGADDTVFEEMDLPGRWKPKLIVGIGGFTKVRQYDQIP
IEICGHKVMGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210LW, T215Y   K103NST   T39A, K64R, W88C, K104KR, I135V, K166KI V111VM
>1444-30603| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKTRSVTVLDMGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTIILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006