<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1743 1743-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F I13V, K20MR, E35D, M36I, N37D, R41RK, R57RK, L63P, A71AV, L89IM, I93IL  
>1743-30515| codons 4-99
TLWQRPFVTVKIGGQLREALLDTGADDTVLEDIDLPGKWKPKIVGGIGGFVKVKQYDQIP
IEICGHKVIGTVLVGPTPVNVIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184I, L210W, T215Y K219R K101P, K103S   T39DE, E44D, V118I, K122E, T200TA, E203K, Q207QE, H208Y, R211K, K223Q, V245K  
>1743-30515| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLPKSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYIDDLYVGSDLEIGQHRAKIKELREYLWKWGFYTP
DRKHQQEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006