<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1140 1140-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, L90M V11I, L33F, Q58E L10I, I13V, L63P, A71V, V77I, I93L  
>1140-30318| codons 4-99
TLWQRPIITVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFMKVREYDQIP
IEICGHKVIGTVVIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R T215TI, K219E K103NS, Y181C   T39A, V60I, T69N, K102Q, K122E, Q174R, D177E, I178M, V179VI, G196GEKR, T200A, Q207E, R211RK, F214L, L228H  
>1140-30318| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEMIICQYMDDLYVGSDLEIRQHRAKIEELREHLLKWGLITP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006