<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1435 1435-30728 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, I84V, L90M L33F, G73S, L89V V11L, I13V, R57K, D60E, I62V, L63P, I66F, A71V, I72M, V77I R87S
>1435-30728| codons 4-99
TLWQRPLLTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFMKVKQYEQVP
IEFCGHKVMSTVLIGPTPVNVIGSNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F116Y, T215CS, K219E G190Q V179VD E53ED, K64R, S68K, D121H, K122E, D177E, T200R, I202V, Q207E, V245E  
>1435-30728| codons 38-247
CTEMEKEGKISKIGPDNPYNTPVFVIRKKDKTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIDIYQYMDDLYVQSDLEIGQHRRKVEELREHLLRWGFSTP
DEKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006