<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1433 1433-30226 Unknown 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54LV, V82VA, I84IV, L90M L10F, G73GAST T12TP, I13IV, K20I, M36MI, N37ND, K55KR, D60DE, I62V, L63P, I64IV, A71AT, I72IT, T74TS, V77VI  
>1433-30226| codons 4-99
TLWQRPFVPVKIGGQLIEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVRVRQYEQVP
VEICGHKTTTSVLIGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K65KR, Y115YF, Q151KM, L210SW A62AV, V75VI, F77FL, F116FY, T215DV, K219KQ K101AP, Y181YC, G190GA   K64KR, S68SR, K102KQ, L109LM, V118VI, K122E, I135T, S162SC, E169ED, K173KN, I202IV, R211K, F214FL, H221HY D113Y
>1433-30226| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIRRKDRTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLPQKKSVTVMDVGYAFYSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQCSMTKILDPFRNQNPDIVICQYMDDLYVASDLEIGQHRTKVEELRQHLWKWGLVTP
DQKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006