<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1135 1135-30512 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V, L90M L33F, G73S, T74P N37D, I62V, L63P, A71V  
>1135-30512| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKLIGGIGGFIKVRQYDQVP
IEICGHKVISPVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W T215D     K65KE, K122E, D123E, I135IT, I142V, S162C, T200A, D237DE  
>1135-30512| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKEKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLWRWGFDTP
DKKHQKEPPFLWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006