<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1133 1133-30326 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82VA, I84V, L90LM V11VI, L33F, F53L L10I, T12A, I13V, E34K, R41K, K55R, L63P, A71V, I72IV, V77VI, I93L  
>1133-30326| codons 4-99
TLWQRPIIAVKIGGQLKEALLDTGADDTVFKEMNLPGKWKPKMIGGIGGLLRVRQYDQIP
IEICGHKVVGTVLIGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219Q K103N   T39A, V60I, V118I, K122E, I135T, T200I, Q207E, H208Y, R211K, D218E  
>1133-30326| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRIKIEELREYLWKWGFYTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006