<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1128 1128-30311 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L33F, K43T, T74P L10I, I13V, K20R, E35D, M36I, N37D, I62IV, L63P, A71V, I93L  
>1128-30311| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEDIDLPGRWTPKLIGGIGGFVKVRQYDQVP
IEICGHKVIGPVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R     K43E, E44A, V106I, V118I, K122E, S162Y, V179I, E203EK, E204Q, Q207E, H208Y, K223Q, L228R L246R
>1128-30311| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIGQHRTKIKQLREYLWRWGFYTP
DRKHQQEPPFRWMGYELHPDKWTVQPIVRP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006