<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2080 2080-30616 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, K70KNT, F116Y Y181C, G190A   T69S, K122E, D123E, S162A, F214L  
>2080-30616| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSSTWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQASMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, I84V   L10V, K20R, M36I, R41K, L63P, I93L  
>2080-30616| codons 4-99
TLWQRPVVTIKIGGQLREALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPTNVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006