<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2157 2157-30619 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, V75T, M184V, L210W, T215Y K219DN L100I, K103S   K102KR, V118I, K122KE, I142V, S162SN, T200TA, R211RK, V245T  
>2157-30619| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVTDFRELNKRTQDFWEVQLGIPHP
AGIKRSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, G48GS, I54M, V82A, L90LM L33F, K43T, F53L L10I, G16E, E34Q, D60E, L63A, A71V, V77I, I93L  
>2157-30619| codons 4-99
TLWQRPIVTIKIEGQLKEALLDTGADDTIFQEMNLPGRWTPKIVSGIGGLMKVRQYEQIA
IEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006