<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2079 2079-30612 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54L, I84V, L90M L10F, L33F, G73C E34EKQ, E35ED, I62IV, L63P, I64V, I66V, A71T, I72L, I93L, C95F  
>2079-30612| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTIFQDMNLPGRWKPKLIGGIGGFLKVRQYDQVP
VEVCGHKTLCTVLVGPTPVNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K43E, E44A, V118I, K122E, I135T, D177E, T200A, V245K  
>2079-30612| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006