<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2078 2078-30612 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, K14R, L19I, K20T, R41K, K45KR, I64V, A71V, V77I  
>2078-30612| codons 4-99
TLWQRPLVTVRIGGQITEALLDTGADNTVLEEMNLPGKWKPRMIGGIGGFIKVRQYDQIL
VEICGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E138A, S162C, I178M, D192H, G196E, Q207E, F214L  
>2078-30612| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDMVIYQYVDDLYVGSHLEIEQHRTKIEELREHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006