<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1883 1883-30604 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A L33LF L10I, I13IV, K20R, M36I, N37D, L63P, I64IV, K70R, A71V, Q92QK  
>1883-30604| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEEIDLPGRWKPKIIGGVGGFVKVRQYDQIP
VEICGHRVIGTVLVGPTPANIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V K219N L100I, K103N   T39A, R83K, K122E, S162C, K173R, Q174R, G196E, Q207H, R211Q, F214FL, L228LH  
>1883-30604| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRRRNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELRHHLLQWGLTTP
DNKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006