<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1884 1884-30604 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10I, I13V, K20I, R41RK, L63P, I64V, H69Q, I72R  
>1884-30604| codons 4-99
TLWQRPIVTVKIGGQLIEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYDQIP
VEICGQKARTTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FV K219Q     K49Q, V60VI, V118I, I135T, A158AS, I178L, F214L, L228H, P243T, V245E  
>1884-30604| codons 38-247
CTEMEKEGKISQIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRKQNPDLVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLVTP
DQKHQKEPPFHWMGYELHPDKWTVQTIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006