<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1882 1882-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, G73S I13V, G16A, K20I, M36I, L63P, A71V  
>1882-30528| codons 4-99
TLWQRPFVTVKIAGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYDQIP
IEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115YF, Q151M K70KN, F77FL, F116Y     V118I, K122E, D123N, I135V, K173N, Q174R, D177E, G196E, T200TI, R211K, F214L N137S
>1882-30528| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTNWRKLVDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFYSIPLDENFRKYTAFTIPSVNSETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRNRNPEIVIYQYMDDLYVGSDLEIEQHRIKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006