<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1881 1881-30520 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54LV, V82A L24I, L33F L10I, T12P, K14R, K20KT, E35D, M36I, N37ND, R41K, L63P, A71T, I72V, N98ND  
>1881-30520| codons 4-99
TLWQRPIVPIRIGGQLTEALIDTGADDTVFEDIDLPGKWKPKLIGGIGGFVKVRQYDQIP
IEICGHKTVGTVLVGPTPANIIGRNLLTQIGCTLDF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, M184V, T215F K219Q K103N   K43N, K49KR, V60I, I135V, G196K, T200A, E203D, R211T, D218E, V245E  
>1881-30520| codons 38-247
CTELENEGKISRIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIKQHRAKIDELRQHLLTWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006