<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1711 1711-30408 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, V82S L24I, L33F, G73GC L10I, I13V, I15V, K20R, E35D, M36I, N37E, K43I, L63P, A71V  
>1711-30408| codons 4-99
TLWQRPIVTVKVGGQLREALIDTGADDTVFEDIELPGRWIPKMIGGIGGFMKVRQYDQIP
IEICGHKVICTVLVGPTPSNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70KQ, V75I, F77L, F116Y Y188L   S68G, K122E, R172K, Q174R, D177E, I178M, V189I, G196E, R211K, F214L  
>1711-30408| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGTQWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFKKRNPEMVIYQYVDDLLIGSDLEIEQHRTKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006